PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001610.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 170aa    MW: 18952.5 Da    PI: 6.4292
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001610.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR126.12.8e-08721075691
                     FAR1  56 aetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                                 rtgC a ++   + +g+w vtk e+ HnHel++
  Itr_sc001610.1_g00005.1  72 IDLRTGCVAFVQFDVDGNGVWTVTKHEKSHNHELCT 107
                              5679******************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.0E-673106IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MAEAVDQLVN ADLVVVSASI DQGDLIVEDS SSIPVDHDLV GIVVSNADEA YELYNDYAYR  60
VVLVLGRAYS KIDLRTGCVA FVQFDVDGNG VWTVTKHEKS HNHELCTLDK SHLLRSHRRV  120
KNNQLSYLRD LKKNGVALAD GIRFLKHQSG GLHSLGSPIE MLTIHWHLIH
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-08FAR1-related sequence 5